PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family WRKY
Protein Properties Length: 151aa    MW: 17130.3 Da    PI: 10.1265
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017706.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.22.9e-3268126159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vk+++fprsYY+Ct++gC+vkk+v+r ++d+ +v++tY g H+h+
  Pbr017706.1  68 LDDGYRWRKYGQKVVKNNKFPRSYYKCTHQGCMVKKQVQRLSKDEGIVVTTYDGIHTHR 126
                  59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-3353126IPR003657WRKY domain
SuperFamilySSF1182908.5E-3060127IPR003657WRKY domain
PROSITE profilePS5081129.21863128IPR003657WRKY domain
SMARTSM007745.2E-3868127IPR003657WRKY domain
PfamPF031065.0E-2669126IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MDHNSQIFFL GSSASSSASP IFSSSRSSFP LCLGDRNAGM MKSGRKEGDK VNKKQKYAFQ  60
TRSQVDILDD GYRWRKYGQK VVKNNKFPRS YYKCTHQGCM VKKQVQRLSK DEGIVVTTYD  120
GIHTHRIDEY SAENLEQIIR HIQASTVPNN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-2958127776Probable WRKY transcription factor 4
2lex_A8e-2958127776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375188.11e-111PREDICTED: probable WRKY transcription factor 75
SwissprotQ9FYA26e-44WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBLM5WAY93e-55M5WAY9_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g01280.t012e-49(Vitis vinifera)
STRINGSi026859m2e-49(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-44WRKY DNA-binding protein 75